Skip to main content

ABCB7 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-89313

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89313
NBP1-89313-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCB7 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCB7 Antibody

Immunocytochemistry/Immunofluorescence: ABCB7 Antibody [NBP1-89313] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ABCB7 Antibody [NBP1-89313] - Staining of human lung shows strong membranous positivity in alveolar cells.

Applications for ABCB7 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCB7

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC)transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes aredivided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of theMDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigenpresentation. This gene encodes a half-transporter involved in the transport of heme from the mitochondria to thecytosol. With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis.Mutations in this gene have been implicated in X-linked sideroblastic anemia with ataxia. (provided by RefSeq)

Alternate Names

ABC transporter 7 protein, ABC7ATP-binding cassette sub-family B member 7, mitochondrial, ASATATP-binding cassette 7, Atm1p, ATP-binding cassette transporter 7, ATP-binding cassette, sub-family B (MDR/TAP), member 7, EC 3.6.3, EC 3.6.3.42, EST140535

Entrez Gene IDs

22 (Human)

Gene Symbol

ABCB7

UniProt

Additional ABCB7 Products

Product Documents for ABCB7 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCB7 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...