Skip to main content

ABCA5 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-68798

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-68798
NBP2-68798-25ul

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCA5 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKASLVSTMS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCA5 Antibody

Immunocytochemistry/Immunofluorescence: ABCA5 Antibody [NBP2-68798] - Staining of human cell line SiHa shows localization to nucleus & nuclear membrane.

Applications for ABCA5 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCA5

ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. ABCA5 is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of ABCA5 results in several transcript variants; however, not all variants have been fully described.

Alternate Names

ABC13, ATP-binding cassette A5, ATP-binding cassette sub-family A member 5, ATP-binding cassette, sub-family A (ABC1), member 5, DKFZp451F117, DKFZp779N2435, EC 3.6.3, EC 3.6.3.25, EC 3.6.3.41, EST90625, FLJ16381, KIAA1888

Gene Symbol

ABCA5

Additional ABCA5 Products

Product Documents for ABCA5 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCA5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...