Skip to main content

ABCA3 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-89310

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89310
NBP1-89310-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCA3 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCA3 Antibody

Immunohistochemistry-Paraffin: ABCA3 Antibody [NBP1-89310] - Analysis in human lung and cervix, uterine tissues using NBP1-89310 antibody. Corresponding ABCA3 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: ABCA3 Antibody [NBP1-89310] - Staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ABCA3 Antibody [NBP1-89310] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes.

Applications for ABCA3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCA3

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC)transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes aredivided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of theABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellulareukaryotes. The full transporter encoded by this gene may be involved in development of resistance to xenobiotics andengulfment during programmed cell death. (provided by RefSeq)

Alternate Names

ABC transporter 3, ABC3MGC72201, ABC-C, ABC-C transporter, ATP-binding cassette 3, ATP-binding cassette sub-family A member 3, ATP-binding cassette transporter 3, ATP-binding cassette, sub-family A (ABC1), member 3, EC 3.6.3, EC 3.6.3.17, EST111653, LBM180, MGC166979, SMDP3

Gene Symbol

ABCA3

Additional ABCA3 Products

Product Documents for ABCA3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCA3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...