Skip to main content

ABCA2 Antibody - Azide and BSA Free, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-92339

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-92339-0.1ml
NBP2-92339-0.02ml

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCA2 Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 140-350 of human ABCA2 (NP_001597.2). SHLDRSTVSSFSLDSVARNPQELWRFLTQNLSLPNSTAQALLAARVDPPEVYHLLFGPSSALDSQSGLHKGQEPWSRLGGNPLFRMEELLLAPALLEQLTCTPGSGELGRILTVPESQKGALQGYRDAVCSGQAAARARRFSGLSAELRNQLDVAKVSQQLGLDAPNGSDSSPQAPPPRRLQALLGDLLDAQKVLQDVDVLSALALLLPQG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCA2 Antibody - Azide and BSA Free

Western Blot: ABCA2 Antibody [NBP2-92339] - Analysis of extracts of various cell lines, using ABCA2 .Exposure time: 3min.
Immunocytochemistry/Immunofluorescence: ABCA2 Antibody [NBP2-92339] - Analysis of U-251 MG cells using ABCA2 . Blue: DAPI for nuclear staining.
Immunohistochemistry: ABCA2 Antibody [NBP2-92339] - Analysis of mouse brain using ABCA2 . Blue: DAPI for nuclear staining.

Applications for ABCA2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ABCA2

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is highly expressed in brain tissue and may play a role in macrophage lipid metabolism and neural development. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

ABC2ATP-binding cassette, sub-family A, member 2, ATP-binding cassette 2, ATP-binding cassette sub-family A member 2, ATP-binding cassette transporter 2, ATP-binding cassette, sub-family A (ABC1), member 2, EC 3.6.3, EC 3.6.3.41, KIAA1062, MGC129761

Gene Symbol

ABCA2

Additional ABCA2 Products

Product Documents for ABCA2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCA2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...