Skip to main content

AATF Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-85634

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-85634
NBP1-85634-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for AATF Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AATF Antibody

Immunohistochemistry-Paraffin: AATF Antibody [NBP1-85634] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Applications for AATF Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AATF

AATF is encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.

Alternate Names

apoptosis antagonizing transcription factor, Apoptosis-antagonizing transcription factor, CHE-1, CHE1Rb-binding protein Che-1, DEDprotein AATF

Gene Symbol

AATF

Additional AATF Products

Product Documents for AATF Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AATF Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...