Skip to main content

AASD-PPT Antibody - Azide and BSA Free, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-92449

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-92449-0.1ml
NBP2-92449-0.02ml

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for AASD-PPT Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human AASDHPPT (NP_056238.2). MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AASD-PPT Antibody - Azide and BSA Free

Western Blot: AASD-PPT Antibody [NBP2-92449] - Analysis of extracts of various cell lines, using AASD-PPT at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.
AASD-PPT Antibody - Azide and BSA Free

Knockout Validated: Rabbit Polyclonal AASD-PPT Antibody [NBP2-92449] -

Knockout Validated: Rabbit Polyclonal AASD-PPT Antibody [NBP2-92449] - A. Wild type or AASD-PPT KO mouse embryonic stem cell samples probed with NBP2-92449 antibody. B. mESCs were transfected with control or FLAG-AASD-PPT plasmids probed with NBP2-92449 antibody. Ponceau staining is shown as loading control. Image from a verified customer review.

Applications for AASD-PPT Antibody - Azide and BSA Free

Application
Recommended Usage

Knockout Validated

Validated for Knockout from a verified customer review.

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 1 review rated 4 using NBP2-92449 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AASD-PPT

AASDHPPT is encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.

Alternate Names

4'-phosphopantetheinyl transferase, AASD-PPTDKFZp566E2346, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, CGI-80, EC 2.7.8, EC 2.7.8.-, L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, LYS2, LYS5, LYS5 ortholog

Gene Symbol

AASDHPPT

Additional AASD-PPT Products

Product Documents for AASD-PPT Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AASD-PPT Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...