Skip to main content

AASD-PPT Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-89322

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89322-25ul
NBP1-89322

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for AASD-PPT Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for AASD-PPT Antibody

Western Blot: AASD-PPT Antibody [NBP1-89322] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: AASD-PPT Antibody [NBP1-89322] - Staining of human testis shows strong cytoplasmic positivity in spermatids.
Western Blot: AASD-PPT Antibody [NBP1-89322] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-9

Applications for AASD-PPT Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AASD-PPT

AASDHPPT is encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.

Alternate Names

4'-phosphopantetheinyl transferase, AASD-PPTDKFZp566E2346, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, CGI-80, EC 2.7.8, EC 2.7.8.-, L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, LYS2, LYS5, LYS5 ortholog

Entrez Gene IDs

60496 (Human)

Gene Symbol

AASDHPPT

UniProt

Additional AASD-PPT Products

Product Documents for AASD-PPT Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AASD-PPT Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...