Skip to main content

AASD-PPT Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00060496-B01P

Catalog #
Availability
Size / Price
Qty
Loading...
H00060496-B01P

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for AASD-PPT Antibody

Immunogen

AASDHPPT (NP_056238.2, 1 a.a. - 309 a.a.) full-length human protein. MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS

Specificity

AASDHPPT - aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase,

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Scientific Data Images for AASD-PPT Antibody

Western Blot: AASD-PPT Antibody [H00060496-B01P] - Analysis of AASDHPPT expression in Jurkat.
Western Blot: AASD-PPT Antibody [H00060496-B01P] - Analysis of AASDHPPT expression in PC-12.
Western Blot: AASD-PPT Antibody [H00060496-B01P] - Analysis of AASDHPPT expression in transfected 293T cell line by AASDHPPT polyclonal antibody. Lane 1: AASDHPPT transfected lysate(33.99 KDa). Lane 2: Non-transfected lysate.

Applications for AASD-PPT Antibody

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: AASD-PPT

The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq]

Alternate Names

4'-phosphopantetheinyl transferase, AASD-PPTDKFZp566E2346, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, CGI-80, EC 2.7.8, EC 2.7.8.-, L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, LYS2, LYS5, LYS5 ortholog

Entrez Gene IDs

60496 (Human)

Gene Symbol

AASDHPPT

Additional AASD-PPT Products

Product Documents for AASD-PPT Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AASD-PPT Antibody

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...