Skip to main content

AAMP Antibody (2H2), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00000014-M02

Catalog #
Availability
Size / Price
Qty
Loading...
H00000014-M02

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 2H2

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for AAMP Antibody (2H2)

Immunogen

AAMP (NP_001078.2, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT

Specificity

AAMP - angio-associated, migratory cell protein (2H2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for AAMP Antibody (2H2)

ELISA: AAMP Antibody (2H2) [H00000014-M02] - Detection limit for recombinant GST tagged AAMP is 0.3 ng/ml as a capture antibody.

Applications for AAMP Antibody (2H2)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: AAMP

The gene product is an immunoglobulin-type protein. It is found to be expressed strongly in endothelial cells, cytotrophoblasts, and poorly differentiated colon adenocarcinoma cells found in lymphatics. The protein contains a heparin-binding domain and mediates heparin-sensitive cell adhesion. [provided by RefSeq]

Alternate Names

angio-associated migratory cell protein, angio-associated, migratory cell protein

Entrez Gene IDs

14 (Human)

Gene Symbol

AAMP

Additional AAMP Products

Product Documents for AAMP Antibody (2H2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AAMP Antibody (2H2)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...