Skip to main content

A4GNT Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-89129

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89129
NBP1-89129-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for A4GNT Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NFVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELG

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:32025032).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for A4GNT Antibody

Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining in human stomach and pancreas tissues using anti-A4GNT antibody. Corresponding A4GNT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: A4GNT Antibody [NBP1-89129] - Staining of human pancreas shows low expression as expected.

Applications for A4GNT Antibody

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP1-89129 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: A4GNT

Alternate Names

alpha-1,4-N-acetylglucosaminyltransferase, alpha4GnT

Entrez Gene IDs

51146 (Human)

Gene Symbol

A4GNT

UniProt

Additional A4GNT Products

Product Documents for A4GNT Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for A4GNT Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...