Skip to main content

15-PGDH/HPGD Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-87062

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87062-25ul
NBP1-87062

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for 15-PGDH/HPGD Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23390522)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 15-PGDH/HPGD Antibody

Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87062] - Analysis in human urinary bladder and cerebral cortex tissues using NBP1-87062 antibody. Corresponding HPGD RNA-seq data are presented for the same tissues.
Western Blot: 15-PGDH/HPGD Antibody [NBP1-87062] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Western Blot: 15-PGDH/HPGD Antibody [NBP1-87062] - Analysis using Anti-HPGD antibody NBP1-87062 (A) shows similar pattern to independent antibody NBP1-87061 (B).

Applications for 15-PGDH/HPGD Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 15-PGDH/HPGD

15-PGDH (15-hydroxyprostaglandin dehydrogenase (NAD+)) is responsible for prostaglandin inactivation and supports the regulation of functions that are controled by prostaglandin levels. Specifically, 15PGDH catalyzes the chemical reaction to convert NAD+ to NADH and H+.

15-PGDH is a novel tumor suppressor in the COX-2 pathway. 15-PGDH is found in many normal tissues and appears to be down-regulated in colorectal and lung carcinoma tissue.

Long Name

15-Hydroxyprostaglandin Dehydrogenase

Alternate Names

15PGDH, HPGD, PGDH1, SDR36C1

Gene Symbol

HPGD

Additional 15-PGDH/HPGD Products

Product Documents for 15-PGDH/HPGD Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 15-PGDH/HPGD Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...