Skip to main content

15-PGDH/HPGD Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-87061

Catalog #
Size / Price

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity




Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot



Antibody Source

Polyclonal Rabbit IgG


Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for 15-PGDH/HPGD Antibody


This antibody was developed against Recombinant Protein corresponding to amino acids: LAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)







Scientific Data Images for 15-PGDH/HPGD Antibody

Western Blot: 15-PGDH/HPGD Antibody [NBP1-87061] - Analysis using Anti-HPGD antibody NBP1-87061 (A) shows similar pattern to independent antibody NBP1-87062 (B).
Immunocytochemistry/Immunofluorescence: 15-PGDH/HPGD Antibody [NBP1-87061] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NBP1-87061] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Applications for 15-PGDH/HPGD Antibody

Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml


1:200 - 1:500


1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage


Immunogen affinity purified


PBS (pH 7.2) and 40% Glycerol


0.02% Sodium Azide


Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.


The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 15-PGDH/HPGD

15-PGDH (15-hydroxyprostaglandin dehydrogenase (NAD+)) is responsible for prostaglandin inactivation and supports the regulation of functions that are controled by prostaglandin levels. Specifically, 15PGDH catalyzes the chemical reaction to convert NAD+ to NADH and H+.

15-PGDH is a novel tumor suppressor in the COX-2 pathway. 15-PGDH is found in many normal tissues and appears to be down-regulated in colorectal and lung carcinoma tissue.

Long Name

15-Hydroxyprostaglandin Dehydrogenase

Alternate Names


Gene Symbol


Additional 15-PGDH/HPGD Products

Product Documents for 15-PGDH/HPGD Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 15-PGDH/HPGD Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
