Skip to main content

15-Lipoxygenase 2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-86925

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-86925

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for 15-Lipoxygenase 2 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human 15-Lipoxygenase 2. Peptide sequence: CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for 15-Lipoxygenase 2 Antibody

Western Blot: 15-Lipoxygenase 2 Antibody [NBP2-86925] - WB Suggested Anti-ALOX15B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human brain

Applications for 15-Lipoxygenase 2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 15-Lipoxygenase 2

15 Lipoxygenase 2 encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Alternate Names

15-lipoxygenase 2, 15-LOX-B, arachidonate 15-lipoxygenase 2, arachidonate 15-lipoxygenase B, Arachidonate 15-lipoxygenase type II, arachidonate 15-lipoxygenase, second type, arachidonate 15-lipoxygenase, type B, arachidonate omega(6) lipoxygenase, EC 1.13.11, EC 1.13.11.33,15-LOX-215S-lipoxygenase

Gene Symbol

ALOX15B

Additional 15-Lipoxygenase 2 Products

Product Documents for 15-Lipoxygenase 2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 15-Lipoxygenase 2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...