Skip to main content

14-3-3 sigma/Stratifin Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-80610

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-80610-25ul
NBP1-80610

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for 14-3-3 sigma/Stratifin Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 sigma/Stratifin Antibody

Immunohistochemistry-Paraffin: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Staining in human skin and skeletal muscle tissues using anti-SFN antibody. Corresponding SFN RNA-seq data are presented for the same tissues.
Western Blot: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Analysis in human cell lines A-431 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Applications for 14-3-3 sigma/Stratifin Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: PFA/Triton X-100
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 2 publications using NBP1-80610 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 14-3-3 sigma

14-3-3 sigma was identified as an epithelial cell marker. It is part of the 14-3-3 family of proteins in which seven isoforms have been identified: beta, zeta, gamma, eta, epsilon, tau, and sigma. 14-3-3 proteins function as adaptors that bind with a number of partners to mediate various signaling pathways. 14-3-3 sigma is also called stratifin or HME1 and appears to function as a tumor suppressor whose expression can be downregulated via methylation. Loss of 14-3-3 sigma expression results in a defective G2/M phase checkpoint and appears to contribute to both epithelial and non-epithelial tumorigenesis. Alternate names for 14-3-3 sigma include epithelial marker protein 1, SFN and YWHAS.

Alternate Names

1433 sigma, Epithelial cell marker protein 1, SFN, YWHAS

Entrez Gene IDs

2810 (Human)

Gene Symbol

SFN

UniProt

Additional 14-3-3 sigma Products

Product Documents for 14-3-3 sigma/Stratifin Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 14-3-3 sigma/Stratifin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...