Skip to main content

14-3-3 epsilon Antibody (4X6E1), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP3-16515

Recombinant Monoclonal Antibody
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16515-20ul
NBP3-16515-100ul

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4X6E1

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for 14-3-3 epsilon Antibody (4X6E1)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 epsilon (P62258). MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 epsilon Antibody (4X6E1)

Western Blot: 14-3-3 epsilon Antibody (4X6E1) [NBP3-16515] - Western blot analysis of extracts of various cell lines, using 14-3-3 epsilon Rabbit mAb (NBP3-16515) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for 14-3-3 epsilon Antibody (4X6E1)

Application
Recommended Usage

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 14-3-3 epsilon

14-3-3 epsilon product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer.

Alternate Names

1433 epsilon, YWHAE

Gene Symbol

YWHAE

Additional 14-3-3 epsilon Products

Product Documents for 14-3-3 epsilon Antibody (4X6E1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 14-3-3 epsilon Antibody (4X6E1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...