Skip to main content

12-Lipoxygenase Antibody (2D10), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00000239-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00000239-M01

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2D10

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for 12-Lipoxygenase Antibody (2D10)

Immunogen

ALOX12 (NP_000688, 564 a.a. ~ 663 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI

Specificity

ALOX12 - arachidonate 12-lipoxygenase (2D10)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for 12-Lipoxygenase Antibody (2D10)

ELISA: 12-Lipoxygenase Antibody (2D10) [H00000239-M01] - Detection limit for recombinant GST tagged ALOX12 is approximately 0.3ng/ml as a capture antibody.

Applications for 12-Lipoxygenase Antibody (2D10)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: 12-Lipoxygenase

Oxygenase and 14,15-leukotriene A4 synthase activity

Long Name

Polyunsaturated fatty acid lipoxygenase ALOX12

Alternate Names

12LO, 12S-lipoxygenase, 12S-LOX, ALOX12, EC 1.13.11.-, EC 1.13.11.31, EC 1.13.11.33, EC 3.3.2.-, LOG12

Entrez Gene IDs

239 (Human)

Gene Symbol

ALOX12

Additional 12-Lipoxygenase Products

Product Documents for 12-Lipoxygenase Antibody (2D10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 12-Lipoxygenase Antibody (2D10)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...