Skip to main content

c-Myc Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56660

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56660-25ul
NBP2-56660

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against a c-Myc Antibody recombinant protein corresponding to the following amino acid sequence: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP

Reactivity Notes

Mouse, Rat (87%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit c-Myc Antibody - BSA Free (NBP2-56660) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for c-Myc Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: c-Myc Antibody [NBP2-56660]

Immunocytochemistry/ Immunofluorescence: c-Myc Antibody [NBP2-56660]

Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NBP2-56660] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
c-Myc Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: c-Myc Antibody - BSA Free [NBP2-56660]

Chromatin Immunoprecipitation-exo-Seq: c-Myc Antibody - BSA Free [NBP2-56660]

ChIP-Exo-Seq composite graph for Anti-MYC (NBP2-56660) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for c-Myc Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: c-Myc

The c-Myc protein is a transcription factor, which is encoded by the c-Myc gene on human chromosome 8q24. c-Myc is a multifunctional, nuclear phosphoprotein that functions as a transcription factor with a theoretical molecular weight of 62kDa. However, c-Myc is extremely labile and is degraded very quickly even in extracts prepared with boiling SDS sample buffer, such that a molecular weight of ~40 kDa has been observed. c-Myc is part of a heterodimeric complex with Max that acts as a potent transcriptional activator. c-Myc is modified by glycosylation and phosphorylation and has been shown to interact with numerous proteins including SMAD2, SMAD3, LSD1/KDM1A, MAD, and Sp1 (1).

A basic Helix-Loop-Helix, Leucine Zipper domain (bHLH/LZ), designated Max, specifically associates with c-Myc, N-Myc and L-Myc proteins. The Myc-Max complex binds to DNA in a sequence-specific manner under conditions where neither Max nor Myc exhibit appreciable binding. Max can also form heterodimers with other bHLH-Zip proteins, Mad and Mxi1. c-Myc plays a role in cell cycle progression, apoptosis, cellular transformation and angiogenesis (2). Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of cancers including B-cell Lymphomas, acute myeloid leukemia, glioblastoma, stomach adenocarcinoma, and prostate adenocarcinoma (3).

References

1. Wilkinson, D. S., Tsai, W. W., Schumacher, M. A., & Barton, M. C. (2008). Chromatin-bound p53 anchors activated Smads and the mSin3A corepressor to confer transforming-growth-factor-beta-mediated transcription repression. Mol Cell Biol, 28(6), 1988-1998. doi:10.1128/mcb.01442-07

2. Pedrosa, A. R., Bodrug, N., Gomez-Escudero, J., Carter, E. P., Reynolds, L. E., Georgiou, P. N., . . . Hodivala-Dilke, K. M. (2019). Tumor Angiogenesis Is Differentially Regulated by Phosphorylation of Endothelial Cell Focal Adhesion Kinase Tyrosines-397 and -861. Cancer Res, 79(17), 4371-4386. doi:10.1158/0008-5472.Can-18-3934

3. Nagasaka, M., Tsuzuki, K., Ozeki, Y., Tokugawa, M., Ohoka, N., Inoue, Y., & Hayashi, H. (2019). Lysine-Specific Demethylase 1 (LSD1/KDM1A) Is a Novel Target Gene of c-Myc. Biol Pharm Bull, 42(3), 481-488. doi:10.1248/bpb.b18-00892

Long Name

v-Myc Avian Myelocytomatosis Viral Oncogene Homolog (Avian)

Alternate Names

cMyc, Myc, Myc2, Niard, Nird

Gene Symbol

MYC

Additional c-Myc Products

Product Documents for c-Myc Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for c-Myc Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...