ω-Agatoxin TK

Name: ω-Agatoxin TK
Brand: Tocris Bioscience
SKU: 2802
Rating: 5 (1 reviews)

Tocris Bioscience, part of Bio-Techne | Catalog # 2802

(1)

Citations (5)

COA / SDS

CaV2.1 blocker

Discontinued Product

2802 has been discontinued. View all Cav2.x Channel Blockers products.

Key Product Details

Description:	Ca_V2.1 blocker
Alternative Names:	Agatoxin IVB
Purity:	≥95% (HPLC)
Molecular Weight:	5273.02

View Full Technical Details for ω-Agatoxin TK

Technical Data
Citations / Reviews (1)

Biological Activity for ω-Agatoxin TK

ω-Agatoxin TK is a selective blocker of Ca_V2.1 P/Q-type calcium channels.

Technical Data for ω-Agatoxin TK

M. Wt	5273.02
Formula	C₂₁₅H₃₃₇N₆₅O₇₀S₁₀
Single Letter Sequence	EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA (Modifications: Disulfide bridges: 4-20, 12-25, 19-36, 27-34)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	158484-42-5
PubChem ID	90488781
InChi Key	MBXCGHHUBOKUGG-UHFFFAOYSA-N
Smiles	[H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC5=C1C=CC=C5)C(=O)NCC(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N4)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for ω-Agatoxin TK

References are publications that support the biological activity of the product.

Barral High-affinity inhibition of glutamate release from corticostriatal synapses by ω-agatoxin TK. Eur.J.Pharmacol. 2001 PMID: 11711028
Teramoto A novel peptide from funnel web spider venom, ω-Aga-TK, selectively blocks P-type calcium channels. Biochem.Biophys.Res.Comms.
Teramoto A novel type of calcium channel sensitive to ω-agatoxin-TK in cultured rat cerebral cortical neurons. Brain Res. 1997 PMID: 9187336

ω-Agatoxin TK

Tocris Bioscience, part of Bio-Techne | Catalog # 2802

Key Product Details

Biological Activity for ω-Agatoxin TK

Technical Data for ω-Agatoxin TK

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for ω-Agatoxin TK

Product Documents for ω-Agatoxin TK

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected