SNX 482

Name: SNX 482
Brand: Tocris Bioscience
SKU: 2945

Tocris Bioscience, part of Bio-Techne | Catalog # 2945

Citations (38)

COA / SDS

Potent and selective CaV2.3 blocker

Discontinued Product

2945 has been discontinued. View all Cav2.x Channel Blockers products.

Key Product Details

Description:	Potent and selective Ca_V2.3 blocker
Molecular Weight:	4495.01

View Full Technical Details for SNX 482

Technical Data
Citations

Biological Activity for SNX 482

SNX 482 is a potent and selective, voltage-dependent R-type Ca_V2.3 calcium channel blocker (IC₅₀ = 30 nM). Antinociceptive; inhibits nociceptive C-fibre and Aδ-fibre-evoked neuronal responses.

Technical Data for SNX 482

M. Wt	4495.01
Formula	C₁₉₂H₂₇₄N₅₂O₆₀S₇
Single Letter Sequence	GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD (Modifications: Disulfide bridge between 7 - 21, 14 - 26, 20 - 33)
Storage	Desiccate at -20°C
CAS Number	203460-30-4
PubChem ID	90488787
InChi Key	NSUPRLHDCFNOKD-UHFFFAOYSA-N
Smiles	[H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CCCNC(N)=N)NC1=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N3)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C2=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for SNX 482

References are publications that support the biological activity of the product.

Bourinet Interaction of SNX482 with domains III and IV inhibits activation gating of α_1E (Ca_V2.3) calcium channels. Biophys.J. 2001 PMID: 11423396
Matthews The Ca_V2.3 calcium channel antagonist SNX-482 reduces dorsal horn neuronal responses in a rat model of chronic neuropathic pain. Eur.J.Neurosci. 2007 PMID: 17610575
Newcomb Selective peptide antagonist of the class E calcium channel from the venom of the Tarantula Hysterocrates gigas. Biochemistry 1998 PMID: 9799496

SNX 482

Tocris Bioscience, part of Bio-Techne | Catalog # 2945

Key Product Details

Biological Activity for SNX 482

Technical Data for SNX 482

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for SNX 482

Product Documents for SNX 482

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected