Oxyntomodulin (porcine, bovine)

Name: Oxyntomodulin (porcine, bovine)
Brand: Tocris Bioscience
SKU: 2094

Tocris Bioscience, part of Bio-Techne | Catalog # 2094

COA / SDS

GLP-1 receptor agonist; endogenous preproglucagon derived peptide; modulates feeding and metabolism

Discontinued Product

2094 has been discontinued. View all GLP-1 Receptor Peptides products.

Key Product Details

Description:	GLP-1 receptor agonist; endogenous preproglucagon derived peptide; modulates feeding and metabolism
Alternative Names:	Glucagon (1-37),Enteroglucagon
Purity:	≥95% (HPLC)
Molecular Weight:	4421.86

View Full Technical Details for Oxyntomodulin (porcine, bovine)

Technical Data
Citations

Biological Activity for Oxyntomodulin (porcine, bovine)

Oxyntomodulin (porcine, bovine) is a GLP-1 receptor agonist. Endogenous preproglucagon-derived neuropeptide that modulates feeding and metabolism. Also secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach. Also weak glucagon receptor agonist.

Technical Data for Oxyntomodulin (porcine, bovine)

M. Wt	4421.86
Formula	C₁₉₂H₂₉₅N₅₉O₆₀S
Single Letter Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	62340-29-8
PubChem ID	16144019
InChi Key	PXZWGQLGAKCNKD-DPNMSELWSA-N
Smiles	[H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Oxyntomodulin (porcine, bovine)

References are publications that support the biological activity of the product.

Vrang and Larsen Preproglucagon derived peptides GLP-1, GLP-2 and oxyntomodulin in the CNS: role of peripherally secreted and centrally produced peptides. Prog.Neurobiol. 2010 PMID: 20638440
Stumpel A new role for enteric glucagon-37: acute stimulation of glucose absorption in rat small intestine. FEBS Lett. 1997 PMID: 9237694
Jarrousse Oxyntomodulin (glucagon-37) and its C-terminal octapeptide inhibit gastric acid secretion. FEBS Lett. 1985 PMID: 4018272
Bataille Bioactive enteroglucagon (oxyntomodulin): present knowledge on its chemical structure and its biological activities. Peptides 1981 PMID: 6283496

Oxyntomodulin (porcine, bovine)

Tocris Bioscience, part of Bio-Techne | Catalog # 2094

Key Product Details

Biological Activity for Oxyntomodulin (porcine, bovine)

Technical Data for Oxyntomodulin (porcine, bovine)

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for Oxyntomodulin (porcine, bovine)

Product Documents for Oxyntomodulin (porcine, bovine)

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected