Amyloid β-peptide (1-42) (rat)

Name: Amyloid β-peptide (1-42) (rat)
Brand: Tocris Bioscience
SKU: 2425

Tocris Bioscience, part of Bio-Techne | Catalog # 2425

Citations (3)

COA / SDS

Predominant amyloid β-protein fragment

Discontinued Product

2425 has been discontinued. View all Amyloid beta Peptides products.

Key Product Details

Description:	Predominant amyloid β-protein fragment
Purity:	≥95% (HPLC)
Molecular Weight:	4417.99

View Full Technical Details for Amyloid β-peptide (1-42) (rat)

Technical Data
Citations

Biological Activity for Amyloid β-peptide (1-42) (rat)

Amyloid β-peptide (1-42) (rat) is a rat form of the predominant amyloid β-peptide found in plaques associated with Alzheimer's disease. Leads to a large shift in the bax/bcl-2 ratio in favour of pro-apoptotic bax. Neurotoxic.

Technical Data for Amyloid β-peptide (1-42) (rat)

M. Wt	4417.99
Formula	C₁₉₉H₃₀₇N₅₃O₅₉S
Single Letter Sequence	DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	166090-74-0
PubChem ID	71581490
InChi Key	HAWSUONKNKRLRH-ANECVMDESA-N
Smiles	[H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Amyloid β-peptide (1-42) (rat)

References are publications that support the biological activity of the product.

Glenner and Wong Alzheimer's disease: initial report of the purification and characterization of a novel cerebrovascular amyloid protein. Biochem.Biophys.Res.Comm.
Clementi Alzheimer's amyloid β-peptide (1-42) induces cell death in human neuroblastoma via bax/bcl-2 ratio increase: An intriguing role for methionine 35. Biochem.Biophys.Res.Comm.
Van Nostrand Amyloid β-protein induces the cerebrovascular cellular pathology of Alzheimer's disease and related disorders. Ann.N.Y.Acad.Sci. 1996 PMID: 8624102

Amyloid β-peptide (1-42) (rat)

Tocris Bioscience, part of Bio-Techne | Catalog # 2425

Key Product Details

Biological Activity for Amyloid β-peptide (1-42) (rat)

Technical Data for Amyloid β-peptide (1-42) (rat)

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for Amyloid β-peptide (1-42) (rat)

Product Documents for Amyloid β-peptide (1-42) (rat)

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected