Amylin (rat)

Name: Amylin (rat)
Brand: Tocris Bioscience
SKU: 6030

Tocris Bioscience, part of Bio-Techne | Catalog # 6030

COA / SDS

Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors

Discontinued Product

6030 has been discontinued. View all Calcitonin and Related Receptor Agonists products.

Key Product Details

Description:	Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors
Molecular Weight:	3920.43

View Full Technical Details for Amylin (rat)

Technical Data
Citations

Biological Activity for Amylin (rat)

Amylin (rat) is a potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors (pEC₅₀ values are 7.06-9.50 at hCT_a, 8.11 at rCT_a, 7.73-10.1 at hAMY1_a, 9.74 at rAMY1_a, 7.92 at hAMY1_b, 7.78-9.9 at hAMY_2a, 7.94 at hAMY_2b, 8.09-10.8 at hAMY_3a, 9.97 at rAMY and 8.19 at hAMY_3b) receptors. Suppresses insulin-stimulated glucose uptake. Delays gastric emptying and promotes satiety. Active in vivo.

Technical Data for Amylin (rat)

M. Wt	3920.43
Formula	C₁₆₇H₂₇₂N₅₂O₅₃S₂
Single Letter Sequence	KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY (Modifications: Tyr-37 = C-terminal amide, Disulfide bridge between 2 - 7)
Storage	Store at -20°C
CAS Number	124447-81-0
PubChem ID	123773280
InChi Key	AGQDOUOEJSDDQH-BJQYWQRQSA-N
Smiles	[H]N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Amylin (rat)

References are publications that support the biological activity of the product.

Bower Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br.J.Pharmacol. 2016 PMID: 27061187

Amylin (rat)

Tocris Bioscience, part of Bio-Techne | Catalog # 6030

Key Product Details

Biological Activity for Amylin (rat)

Technical Data for Amylin (rat)

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for Amylin (rat)

Product Documents for Amylin (rat)

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected