Skip to main content

Recombinant Human SynGAP GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00008831-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00008831-Q01-25ug
H00008831-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 3-98 of Human SynGAP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: YAPFRDVRGPSMHRTQYVHSPYDRPGWNPRFCIISGNQLLMLDEDEIHPLLIRDRRSESSRNKLLRRTVSVPVEGRPHGEHEYHLGRSRRKSVPGG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SynGAP GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00008831-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: SynGAP

Synaptic Ras GTPase Activating Protein (SynGAP) is a PDZ-domain interacting protein expressed almost exclusively in the brain. SynGAP has been shown to be a major component of postsynaptic density and associates with post synaptic density 95 kDa (PSD-95), a synaptic scaffold protein, and synaptic N-methyl-D-aspartate (NMDA) receptors. SynGAP Ras-GTPase activity has also been shown to be inhibited by phosphorylation by CaM kinase II, another abundant protein located in the postsynaptic density. It has been proposed that SynGAP may function as a negative regulator of MAP Kinase activation in the absence of active NMDA receptors.

Alternate Names

DKFZp761G1421, KIAA1938135kDa, MRD5, synaptic Ras GTPase activating protein 1, synaptic Ras GTPase activating protein 1 homolog (rat), Synaptic Ras-GAP 1

Gene Symbol

SYNGAP1

Additional SynGAP Products

Product Documents for Recombinant Human SynGAP GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human SynGAP GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...