Recombinant Human SPAG9 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00009043-P01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
Western Blot, ELISA, Affinity Purification, Microarray
Product Specifications
Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-131 of Human SPAG9
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MSPGCMLLFVFGFVGGAVVINSAILVSLSVLLLVHFSISTGVPALTQNLPRILRKERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEVRMVLLNTLQKVY
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
40.04 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human SPAG9 GST (N-Term) Protein
SDS-PAGE: Recombinant Human SPAG9 GST (N-Term) Protein [H00009043-P01]
SDS-Page: Recombinant Human SPAG9 Protein [H00009043-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation and Storage
H00009043-P01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: SPAG9
Alternate Names
Cancer/testis antigen 89, c-Jun NH2-terminal kinase-associated leucine zipper protein, C-Jun-amino-terminal kinase-interacting protein 4, CT89JIP4, FLJ14006, FLJ26141, FLJ34602, HLC4, HLC-6, HSS, Human lung cancer oncogene 6 protein, JLPPHETSYD1FLJ13450, JNK interacting protein, JNK/SAPK-associated protein, JNK-associated leucine-zipper protein, JNK-interacting protein 4, KIAA0516JIP-4, lung cancer oncogene 4, MAPK8IP4, Max-binding protein, MGC117291, MGC14967, MGC74461, Mitogen-activated protein kinase 8-interacting protein 4, PIG6, proliferation-inducing gene 6, Proliferation-inducing protein 6, Protein highly expressed in testis, sperm associated antigen 9, Sperm surface protein, Sperm-associated antigen 9, Sperm-specific protein, Sunday driver 1
Gene Symbol
SPAG9
Additional SPAG9 Products
Product Documents for Recombinant Human SPAG9 GST (N-Term) Protein
Product Specific Notices for Recombinant Human SPAG9 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...