Skip to main content

RTN1-A/NSP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38527PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38527PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RTN1.

Source: E. coli

Amino Acid Sequence: SITPPSSGTEPSAAESQGKGSISEDELITAIKEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38527.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38527PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RTN1-A/NSP

Reticulon-1 (RTN1) is multi-pass membrane protein that is a member of a family of conserved proteins that are primarily located in the endoplasmic reticulum (ER) and play a role in promoting membrane curvature. Reticulons (RTN1-4) share a conserved reticulon homology domain in their C-terminus, which is important for the localization of RTNs in the ER as they do not contain the canonical N-terminal ER-localization signal. Alternative splicing of the human gene generates two major isoforms, RTN1-A and RTN1-C, and, to a lesser extent, a third variant termed RTN1-B. The canonical isoform, RTN1-A, also known as Neuroendocrine-specific Protein (NSP), is 776 amino acids (aa) in length with a predicted molecular weight of approximately 135 kDa. RTN1-C lacks aa 1-568 and contains a 20 aa substitution for aa 569-588. RTN1-B lacks aa 1-420. Human RTN1-A/NSP shares 82% aa sequence identity with the rat ortholog. RTN1 is widely expressed in neurons in the developing and mature brain, as well as in neuroendocrine tissue. It is suggested to play a role in neuronal differentiation and DNA binding/epigenetic modifications. RTN1-A/NSP has been shown to form a stable association with the ryanodine receptor RyR2 and modify RyR2-mediated calcium signaling. Research has also shown that RTN1-A/NSP may also function as a potential growth cone marker in elongating neurons.

Long Name

Reticulon 1A/Neuroendocrine-specific Protein

Alternate Names

NSP-A, RTN1, RTN1A

Gene Symbol

RTN1

Additional RTN1-A/NSP Products

Product Documents for RTN1-A/NSP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RTN1-A/NSP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...