RTN1-A/NSP Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38527PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: SITPPSSGTEPSAAESQGKGSISEDELITAIKEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVS
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-38527PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: RTN1-A/NSP
Reticulon-1 (RTN1) is multi-pass membrane protein that is a member of a family of conserved proteins that are primarily located in the endoplasmic reticulum (ER) and play a role in promoting membrane curvature. Reticulons (RTN1-4) share a conserved reticulon homology domain in their C-terminus, which is important for the localization of RTNs in the ER as they do not contain the canonical N-terminal ER-localization signal. Alternative splicing of the human gene generates two major isoforms, RTN1-A and RTN1-C, and, to a lesser extent, a third variant termed RTN1-B. The canonical isoform, RTN1-A, also known as Neuroendocrine-specific Protein (NSP), is 776 amino acids (aa) in length with a predicted molecular weight of approximately 135 kDa. RTN1-C lacks aa 1-568 and contains a 20 aa substitution for aa 569-588. RTN1-B lacks aa 1-420. Human RTN1-A/NSP shares 82% aa sequence identity with the rat ortholog. RTN1 is widely expressed in neurons in the developing and mature brain, as well as in neuroendocrine tissue. It is suggested to play a role in neuronal differentiation and DNA binding/epigenetic modifications. RTN1-A/NSP has been shown to form a stable association with the ryanodine receptor RyR2 and modify RyR2-mediated calcium signaling. Research has also shown that RTN1-A/NSP may also function as a potential growth cone marker in elongating neurons.
Long Name
Alternate Names
Gene Symbol
Additional RTN1-A/NSP Products
Product Documents for RTN1-A/NSP Recombinant Protein Antigen
Product Specific Notices for RTN1-A/NSP Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.