Skip to main content

Recombinant Human NIFK GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00084365-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00084365-P01-10ug
H00084365-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-293 of Human MKI67IP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

60.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human NIFK GST (N-Term) Protein

SDS-PAGE: Recombinant Human NIFK GST (N-Term) Protein [H00084365-P01]

SDS-PAGE: Recombinant Human NIFK GST (N-Term) Protein [H00084365-P01]

SDS-Page: Recombinant Human NIFK Protein [H00084365-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00084365-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: NIFK

NIFK is a nucleolar protein that interacts with Ki67, a protein strongly associated with, and a specific marker of, cell proliferation. The marsupial counterpart of human NIFK was recently identified and suggests that NIFK may be involved in the organization of higher order chromatin structure. NIFK was found to interact with the forkhead associated domain of Ki67 in mitotic cells and the interaction is thought to be phosphorylation-dependent.

Alternate Names

hNIFK, MKI67 (FHA domain) interacting nucleolar phosphoprotein, MKI67 FHA domain-interacting nucleolar phosphoprotein, NIFKNOPP34, Nopp34, Nucleolar phosphoprotein Nopp34, Nucleolar protein interacting with the FHA domain of pKI-67

Gene Symbol

NIFK

Additional NIFK Products

Product Documents for Recombinant Human NIFK GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human NIFK GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...