HOXB4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33833PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-33833PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all HOXB4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXB4.

Source: E. coli

Amino Acid Sequence: CEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33833.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33833PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HOXB4

Homebox transcription factors (Hox) are encoded by highly conserved developmental genes that are involved embryonic and early hematopoietic development. Specifically, Homeobox B4 (HoxB4) is a transcription factor encoded by HOXB4 gene and it is involved in the developmental regulation of specific positional identities on the anterior-posterior axis of cells. Like all members of HOX family, HoXB4 is abundantly expressed in primitive hematopoietic stem cell (HSC), but then decline with lineage-specific terminal differentiation (1). In HSC, stem cell self-renewal activity is regulated by USF1/2 binding to HoxB4, where binding possibly favors stem cell self-renewal instead of cell differentiation. Jun-B and Fra-1 has been linked as key mediators during cell proliferation and differentiation induced by HoxB4, which leads to increase expression of Cyclin D1 and G1 shortening (2).

Long Name

Homeobox B4

Alternate Names

Hox-2.6, HOX2F

Gene Symbol

HOXB4

Additional HOXB4 Products

Product Documents for HOXB4 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HOXB4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.