Skip to main content

Recombinant Human GBL GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00064223-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00064223-P01-25ug
H00064223-P01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-326 of Human MLST8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

62.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human GBL GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00064223-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: GBL

G-protein beta-subunit-like (GBL), also known as MTOR Associated Protein, LST8 Homolog (mLST8), is a 326 amino acid (aa) protein that is comprised of seven WD40 repeats and has a predicted molecular weight of approximately 36 kDa. The human protein shares 97% aa sequence identity with the mouse and rat orthologs. GBL binds the kinase domain of TOR and has been shown to stimulate its activity. GBL is found in both complexes formed by TOR, TORC1 and TORC2. It is required for TORC1-dependent phosphorylation of p70 S6 Kinase and IRS1 following stimulation with serum and insulin, and TORC2-dependent phosphorylation of Akt on Ser473 in response to serum, Insulin, and IFN-beta. GBL also negatively regulates TNF-alpha-induced NFkB activation via binding to IKK alpha and IKK beta. The physiological importance of GBL is highlighted by the fact that knockout mice display embryonic lethality, possibly due to defective vascular development. Additionally, female mice harboring heterozygous null mutations for both TOR and GBL have an increased life span, suggesting that GBL may also be involved in the aging process.

Long Name

G protein beta subunit-like

Alternate Names

mLST8

Gene Symbol

MLST8

Additional GBL Products

Product Documents for Recombinant Human GBL GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human GBL GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...