Claudin-23 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24747PEP
Key Product Details
Conjugate
Applications
Product Specifications
Description
Source: E.coli
Amino Acid Sequence: VSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPM
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Purity
Applications
Application Notes
Protein / Peptide Type
Formulation, Preparation and Storage
NBP3-24747PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Claudin-23
Claudins are transmembrane proteins with four membrane-spanning regions that serve as the major cell-adhesion molecules of tight junctions. Tight junctions restrict the flow of ions and aqueous molecules between cells, and their permeability is determined by the profile of claudin expression and arrangement of claudins with other proteins at the paracellular barrier. The combination and proportion of claudins vary among different cell types.
Alternate Names
Gene Symbol
Additional Claudin-23 Products
Product Documents for Claudin-23 Recombinant Protein Antigen
Product Specific Notices for Claudin-23 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.