Skip to main content

Recombinant Human CD11b GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00003684-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00003684-Q01-10ug
H00003684-Q01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 111-220 of Human CD11b

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human CD11b GST (N-Term) Protein

SDS-PAGE: Recombinant Human CD11b GST (N-Term) Protein [H00003684-Q01]

SDS-PAGE: Recombinant Human CD11b GST (N-Term) Protein [H00003684-Q01]

SDS-Page: Recombinant Human CD11b Protein [H00003684-Q01] - 12.5% SDS-PAGE using Recombinant Human CD11b Protein [H00003684-Q01] stained with Coomassie Blue.

Formulation, Preparation and Storage

H00003684-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: CD11b/Integrin alpha M

CD11b (integrin alpha M subunit) is a type I transmembrane glycoprotein. CD11b combines with the Integrin beta 2 subunit (CD18) to form the non-covalent heterodimer Integrin alpha M/beta 2, also known as Mac-1 and complement receptor type 3 (CR3). The CD11b/CD18 (Mac-1) heterodimer has a theoretical molecular weight of 127kDa but is often observed near 170kDa due to post translational modifications. Integrins are transmembrane proteins that mediate interactions between adhesion molecules on adjacent cells and/or the extracellular matrix. Integrins have diverse roles in several biological processes, including cell migration during development, wound healing, cell differentiation, and apoptosis. The particular integrin CD11b is known as a pro-inflammatory molecule given its ability to promote phagocyte cytotoxic functions while enhancing several effector molecules such as FcGR, uPAR, and CD14 (1). In macrophages, CpG-DNA stimulates lysosomal degradation and vacuolar acidification, subsequently promoting CD11b release via TLR9 (2). During an acute infection, high CD11b/Mac-1 expression on antigen-specific CD8 (+) T cells can signify recent activation of the immune system, whereas naive T cells and virus-specific memory CD8 (+) T cells express little or no Mac-1 when exposed to a virus (3). Variations at the ITGAM gene, which encodes for the CD11b chain of the Mac-1 integrin, is one of the main genetic risk factors involved in systemic lupus erythematosus /SLE disorder (4).

References

1. Rosetti, F., & Mayadas, T. N. (2016). The many faces of Mac-1 in autoimmune disease. Immunol Rev, 269(1), 175-193. doi:10.1111/imr.12373

2. Kim, D., Kim, T. H., Wu, G., Park, B. K., Ha, J. H., Kim, Y. S., . . . Kwon, H. J. (2016). Extracellular Release of CD11b by TLR9 Stimulation in Macrophages. PLoS One, 11(3), e0150677. doi:10.1371/journal.pone.0150677

3. Christensen, J. E., Andreasen, S. O., Christensen, J. P., & Thomsen, A. R. (2001). CD11b expression as a marker to distinguish between recently activated effector CD8(+) T cells and memory cells. Int Immunol, 13(4), 593-600. doi:10.1093/intimm/13.4.593

4. Nath, S. K., Han, S., Kim-Howard, X., Kelly, J. A., Viswanathan, P., Gilkeson, G. S., . . . Harley, J. B. (2008). A nonsynonymous functional variant in integrin-alpha(M) (encoded by ITGAM) is associated with systemic lupus erythematosus. Nat Genet, 40(2), 152-154. doi:10.1038/ng.71

Alternate Names

CD11b, Integrin alpha M, ITGAM

Gene Symbol

ITGAM

Additional CD11b/Integrin alpha M Products

Product Documents for Recombinant Human CD11b GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human CD11b GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...
Loading...