Skip to main content

Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17221PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17221PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Carbohydrate Sulfotransferase 5/CHST5

Source: E. coli

Amino Acid Sequence: YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17221.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17221PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Carbohydrate Sulfotransferase 5/CHST5

CHST5 is a gene that codes for a protein with two isoforms, measuring 411 and 417 amino acids in length, with weights of approximately 46 and 47 kDa respectively. CHST5 functions as a sulfotransferase that does not transfer sulfate to longer carbohydrate structures nor does it have activity toward keratin. Current research is being done of several diseases and disorders related to this gene including corneal dystrophy, adenocarcinoma, esophagitis, cholesterol, immunodeficiency, and hepatitis. CHST5 has also been shown to have interactions with CHST1, KERA, LUM, ST#GAL3, and FMOD in pathways such as the metabolism, Maroteaux-Lamy syndrome, and Hunter syndrome pathways.

Alternate Names

CHST5, GlcNAc6ST3, GST4-alpha, hIGn6ST, I-GlcNAc6ST

Gene Symbol

CHST5

Additional Carbohydrate Sulfotransferase 5/CHST5 Products

Product Documents for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...