Skip to main content

VSTM5 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-68809

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-68809-25ul
NBP2-68809

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for VSTM5 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NKCAYKFQRKRRHKLKESTTEEIELEDVEC

Reactivity Notes

Mouse 83%, Rat 83%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VSTM5 Antibody

Immunohistochemistry-Paraffin: VSTM5 Antibody [NBP2-68809] - Staining of human kidney shows strong cytoplasmic and membranous positivity in tubules and distinctly stained glomeruli.

Applications for VSTM5 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VSTM5

Alternate Names

C11orf90

Gene Symbol

VSTM5

Additional VSTM5 Products

Product Documents for VSTM5 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for VSTM5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...