VPS50 Antibody (2D11) - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # H00055610-M01
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 2D11
Format
Azide and BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
FLJ20097 (NP_060137, 862 a.a. ~ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR
Specificity
FLJ20097 - hypothetical protein LOC55610, isoform b
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Description
Novus Biologicals Mouse VPS50 Antibody (2D11) - Azide and BSA Free (H00055610-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-VPS50 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for VPS50 Antibody (2D11) - Azide and BSA Free
Western Blot: VPS50 Antibody (2D11) [H00055610-M01]
Western Blot: FLJ20097 Antibody (2D11) [H00055610-M01] - FLJ20097 monoclonal antibody (M01), clone 2D11. Analysis of FLJ20097 expression in NIH/3T3.Immunocytochemistry/ Immunofluorescence: VPS50 Antibody (2D11) [H00055610-M01]
Immunocytochemistry/Immunofluorescence: FLJ20097 Antibody (2D11) [H00055610-M01] - Analysis of monoclonal antibody to FLJ20097 on HeLa cell . Antibody concentration 10 ug/ml.Immunohistochemistry-Paraffin: VPS50 Antibody (2D11) [H00055610-M01]
Immunohistochemistry-Paraffin: FLJ20097 Antibody (2D11) [H00055610-M01] - Analysis of monoclonal antibody to FLJ20097 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.Applications for VPS50 Antibody (2D11) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for ELISA, immunofluorescence and immunohistochemistry (paraffin).
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: VPS50
Alternate Names
CCDC132, coiled-coil domain containing 132, coiled-coil domain-containing protein 132, EARP/GARPII Complex Subunit VPS50, KIAA1861, Syndetin, VPS50, EARP/GARPII Complex Subunit, VPS54L
Entrez Gene IDs
55610 (Human)
Gene Symbol
VPS50
UniProt
Additional VPS50 Products
Product Documents for VPS50 Antibody (2D11) - Azide and BSA Free
Product Specific Notices for VPS50 Antibody (2D11) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...