TRPM4 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88492

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88492
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all TRPM4 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TRPM4. Peptide sequence: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit TRPM4 Antibody - BSA Free (NBP2-88492) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for TRPM4 Antibody - BSA Free

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492] - Host: Rabbit. Target Name: TRPM4. Sample Type: 293T. Antibody Dilution: 1.0ug/ml
Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492] - WB Suggested Anti-TRPM4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate
Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492] - Host: Rabbit. Target Name: TRPM4. Sample Type: HepG2. Antibody Dilution: 1.0ug/ml
View 2 more images

Applications for TRPM4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRPM4

FUNCTION: Calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca(2+), it is impermeable to it. Mediates transport of monovalent cations (Na(+) > K(+) > Cs(+) > Li(+)), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca(2+) oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. Involved in myogenic constriction of cerebral arteries. Controls insulin secretion in pancreatic beta-cells. May also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca(2+) overload.; ENZYME REGULATION: Gating is voltage-dependent and repressed by decavanadate. Calmodulin-binding confers the Ca(2+) sensitivity. ATP is able to restore Ca(2+) sensitivity after desensitization. Phosphatidylinositol 4,5-biphosphate (PIP2)-binding strongly enhances activity, by increasing the channel's Ca(2+) sensitivity and shifting its voltage dependence of activation towards negative potentials. Activity is also enhanced by 3,5-bis(trifluoromethyl)pyrazole derivative (BTP2). SUBUNIT: Homomultimer. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Widely expressed with a high expression in intestine and prostate. In brain, it is both expressed in whole cerebral arteries and isolated vascular smooth muscle cells.

Long Name

Transient receptor potential cation channel subfamily M member 4

Alternate Names

hTRPM4, LTrpC-4, LTrpC4, Melastatin-4

Gene Symbol

TRPM4

Additional TRPM4 Products

Product Documents for TRPM4 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRPM4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.