TRIM10 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85982

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85982-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

1 mg/ml

View all TRIM10 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM10. Peptide sequence: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TRIM10 Antibody - BSA Free

Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982] - WB Suggested Anti-TRIM10 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:2500. Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that TRIM10 is expressed in HepG2
Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Human Fetal Kidney. Antibody Dilution: 1.0ug/ml
View 6 more images

Applications for TRIM10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM10

TRIM10 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

B30-RING finger protein, HERF1hematopoietic RING finger 1, RFB30MGC141979, RING finger protein 9, RNF9tripartite motif protein 10, tripartite motif containing 10, tripartite motif-containing 10, tripartite motif-containing protein 10, Zn-finger protein

Gene Symbol

TRIM10

Additional TRIM10 Products

Product Documents for TRIM10 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRIM10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.