Skip to main content

Stathmin 1 Antibody (7Y7H4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16396

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16396-100ul
NBP3-16396-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7Y7H4 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Stathmin 1 (P16949). KQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Stathmin 1 Antibody (7Y7H4) (NBP3-16396) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Stathmin 1 Antibody (7Y7H4)

Western Blot: Stathmin 1 Antibody (7Y7H4) [NBP3-16396]

Western Blot: Stathmin 1 Antibody (7Y7H4) [NBP3-16396]

Western Blot: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Western blot analysis of extracts of various cell lines, using Stathmin 1 Rabbit mAb (NBP3-16396) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Stathmin 1 Antibody (7Y7H4)

Immunocytochemistry/ Immunofluorescence: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] -

Immunocytochemistry/ Immunofluorescence: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Confocal imaging of HeLa cells using Stathmin 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
Stathmin 1 Antibody (7Y7H4)

Immunocytochemistry/ Immunofluorescence: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] -

Immunocytochemistry/ Immunofluorescence: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Confocal imaging of paraffin-embedded Mouse brain using Stathmin 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

Applications for Stathmin 1 Antibody (7Y7H4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Stathmin/STMN1

Stathmin (oncoprotein 18, op18) is a ubiquitous cytosolic phosphoprotein with various regulatory functions in cell proliferation, differentiation signaling, and activation (1). In particular, stathmin is involved in the regulation of tubulin dynamics through inhibition of microtubule formation and/or microtubule depolymerization. Stathmin interacts with soulable tubulins (alpha,beta-tubulin) resulting in the formation of T2S complex which sequesters free tubulin, impeding tubulin formation (2). Stathmin activity is regulated through phosphorylation at Ser16, Ser25, Ser38 and Ser63 by various protein kinases (e.g. MAP-kinase, p34cdc2 kinase), weakening stathmin's affinity to tubulin (3). A mutation on stathmin can lead to excess build up of mitotic spindle and with possible consequence of unregulated cell cycles seen in cancer cells (4). Stathmin is also known as the generic member of a protein family which includes neural proteins SCG10, SCLIP and RB3/RB3/RB3. All members in this family exhibits tubulin binding ability.

Alternate Names

LAP18, Metablastin, OP18, Phosphoprotein p19, Prosolin, SMN, STMN1

Gene Symbol

STMN1

Additional Stathmin/STMN1 Products

Product Documents for Stathmin 1 Antibody (7Y7H4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Stathmin 1 Antibody (7Y7H4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...