Skip to main content

SRRM1 Antibody

Catalog # NBP2-85821 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-85821-0.1ml

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for SRRM1 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of SRRM1. Peptide sequence: PSPVQSQSPSTNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SRRM1 Antibody

Western Blot: SRRM1 Antibody [NBP2-85821] - WB Suggested Anti-Srrm1 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Brain
Immunohistochemistry-Paraffin: SRRM1 Antibody [NBP2-85821] - Rabbit Anti-Srrm1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Colon. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec

Applications for SRRM1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRRM1

Part of pre- and post-splicing multiprotein mRNP complexes. Involved in numerous pre-mRNA processing events. Promotes constitutive and exonic splicing enhancer (ESE)-dependent splicing activation by bridging together sequence-specific (SR family proteins, SFRS4, SFRS5 and TRA2B/SFRS10) and basal snRNP (SNRP70 and SNRPA1) factors of the spliceosome. Stimulates mRNA 3'-end cleavage independently of the formation of an exon junction complex. Binds both pre-mRNA and spliced mRNA 20-25 nt upstream of exon-exon junctions. Binds RNA and DNA with low sequence specificity and has similar preference for either double- or single-stranded nucleic acid substrates

Alternate Names

MGC39488, POP101, Ser/Arg-related nuclear matrix protein, serine/arginine repetitive matrix 1, serine/arginine repetitive matrix protein 1, SRm160, SRM160160-KD, SR-related nuclear matrix protein of 160 kDa

Gene Symbol

SRRM1

Product Documents for SRRM1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SRRM1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...