Skip to main content

SLC38A6 Antibody

Catalog # NBP1-81010 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-81010
NBP1-81010-25ul

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for SLC38A6 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24752331).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC38A6 Antibody

Immunocytochemistry/Immunofluorescence: SLC38A6 Antibody [NBP1-81010] - Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules & cell junctions.
Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human cerebral cortex shows moderate membranous positivity in neurons.

Applications for SLC38A6 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC reported in the literature (PMID: 24752331).
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP1-81010 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC38A6

Probable sodium-dependent amino acid/proton antiporter

Alternate Names

N system amino acid transporter NAT-1, SNAT6, solute carrier family 38, member 6

Entrez Gene IDs

145389 (Human)

Gene Symbol

SLC38A6

Product Documents for SLC38A6 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SLC38A6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...