SARS-CoV-2 ORF6 Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16001
Key Product Details
Species Reactivity
SARS-CoV-2
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of coronavirus ORF6 (YP_009724394.1). MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit SARS-CoV-2 ORF6 Antibody - Azide and BSA Free (NBP3-16001) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free
Western Blot: SARS-CoV-2 ORF6 AntibodyAzide and BSA Free [NBP3-16001]
Western Blot: SARS-CoV-2 ORF6 Antibody [NBP3-16001] - Western blot analysis of extracts of 293T cells, using SARS-CoV-2 ORF6 antibody (NBP3-16001) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.Applications for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: SARS-CoV-2 ORF6
SARS-CoV-2 ORF6 is an ER/Golgi membrane protein that disrupts the formation of the nuclear import complex by binding karyopherin alpha 2 (KPNA2) and karyopherin beta 1 (KPNB1) (2, 4). More specifically, it was found that this disruption is mediated by ORF6's localization to the nuclear pore complex (NPC) where it binds Nup98-Rae1 to target the nuclear import pathway (5). This disruption further prevents the transport of signal transducer and activator of transcription 1 (STAT1) and ultimately blocks interferon (IFN) production and antiviral responses (2, 4, 5). It has been hypothesized that the pathology of COVID-19 is largely initiated by the SARS-CoV-2 proteins ORF6 and non-structural protein 1 (NSP1) which together inhibit STAT1 activity (4). The repression of STAT1 thereby instead promotes STAT3 activation and the upregulation of plasminogen activator inhibitor-1 (PAI-1), leading to a cascade of events that are key features of COVID-19 (4). These harmful events include thrombosis, production of cytokines and chemokines by macrophages, profibrotic changes, hypoxia, and eventual T-cell lymphopenia (4). These finding suggest that targeting STAT1 and STAT3 might be beneficial therapeutic strategies for treating COVID-19.
References
1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-1
2. UniProt (P0DTC6)
3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4
4. Matsuyama, T., Kubli, S. P., Yoshinaga, S. K., Pfeffer, K., & Mak, T. W. (2020). An aberrant STAT pathway is central to COVID-19. Cell death and differentiation, 1-17. Advance online publication. https://doi.org/10.1038/s41418-020-00633-7
5. Miorin, L., Kehrer, T., Sanchez-Aparicio, M. T., Zhang, K., Cohen, P., Patel, R. S., Cupic, A., Makio, T., Mei, M., Moreno, E., Danziger, O., White, K. M., Rathnasinghe, R., Uccellini, M., Gao, S., Aydillo, T., Mena, I., Yin, X., Martin-Sancho, L., Krogan, N. J., ... Garcia-Sastre, A. (2020). SARS-CoV-2 Orf6 hijacks Nup98 to block STAT nuclear import and antagonize interferon signaling. Proceedings of the National Academy of Sciences of the United States of America, 202016650. Advance online publication. https://doi.org/10.1073/pnas.2016650117
Alternate Names
2019-nCoV ORF6, 2019-nCoV ORF6 Protein, Accessory Protein 6, COVID-19 Non-structural protein 6, COVID-19 ns6, COVID-19 ORF6, COVID-19 Protein X3, Human coronavirus ORF6 Protein, Non-structural protein 6, NS6, ORF6 protein, SARS-CoV-2, SARS-CoV-2 Accessory Protein 6, SARS-CoV-2 Non-structural protein 6, SARS-CoV-2 ns6, SARSCoV2 ORF6 Protein, SARS-CoV-2 ORF6 Protein, SARS-CoV-2 Protein X3, Severe Acute Respiratory Syndrome Coronavirus 2
Gene Symbol
ORF6
Additional SARS-CoV-2 ORF6 Products
Product Documents for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free
Product Specific Notices for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...