Skip to main content

SARS-CoV-2 nsp12 Antibody - Azide and BSA Free

Catalog # NBP3-15984 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-15984-100ul
NBP3-15984-20ul

Key Product Details

Species Reactivity

SARS-CoV-2

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for SARS-CoV-2 nsp12 Antibody - Azide and BSA Free

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of coronavirus NSP12 (YP_009725307.1). GIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SARS-CoV-2 nsp12 Antibody - Azide and BSA Free

Western Blot: SARS-CoV-2 nsp12 Antibody [NBP3-15984] - Analysis of extracts of normal 293T cells 293T transfected with NSP12 Protein, using SARS-CoV-2 nsp12 antibody (NBP3-15984) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for SARS-CoV-2 nsp12 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:2000 - 1:6000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 50% glycerol, pH7.3

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SARS-CoV-2 nsp12

Alternate Names

Non-structural protein 12, nsp12, ORF1a polyprotein, ORF1ab polyprotein, pp1a, Replicase polyprotein 1a

Gene Symbol

ORF1ab

Product Documents for SARS-CoV-2 nsp12 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SARS-CoV-2 nsp12 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...