Rev-erb A alpha/NR1D1 Antibody (9I2H1)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15898
Recombinant Monoclonal Antibody
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 9I2H1
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 280-360 of human Rev-erb A alpha/NR1D1 (NP_068370.1). SPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Rev-erb A alpha/NR1D1 Antibody (9I2H1)
Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898]
Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] - Western blot analysis of extracts of various cell lines, using Rev-erb A alpha/NR1D1 antibody (NBP3-15898) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898]
Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] - Western blot analysis of extracts of Mouse liver, using Rev-erb A alpha/NR1D1 antibody (NBP3-15898) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898]
Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] - Western blot analysis of extracts of HepG2, using Rev-erb A alpha/NR1D1 antibody (NBP3-15898) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.Applications for Rev-erb A alpha/NR1D1 Antibody (9I2H1)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Rev-erb A alpha/NR1D1
Alternate Names
Ear-1, NR1D1, Reverb A alpha, THRA1, THRAL
Gene Symbol
NR1D1
Additional Rev-erb A alpha/NR1D1 Products
Product Documents for Rev-erb A alpha/NR1D1 Antibody (9I2H1)
Product Specific Notices for Rev-erb A alpha/NR1D1 Antibody (9I2H1)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...