Skip to main content

RASAL3 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-83439

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83439-0.1ml

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Immunohistochemistry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human RASAL3. Peptide sequence: PRKPSVPWQRQMDQPQDRNQALGTHRPVNKLAELQCEVAALREEQKVLSR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RASAL3 Antibody - BSA Free

Western Blot: RASAL3 Antibody [NBP2-83439]

Western Blot: RASAL3 Antibody [NBP2-83439]

Western Blot: RASAL3 Antibody [NBP2-83439] - Host: Rabbit. Target Name: RASAL3. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml
RASAL3 Antibody - BSA Free

Western Blot: RASAL3 Antibody - BSA Free [NBP2-83439] -

ALKBH5 exerts cardioprotective effects by promoting the Ras/Raf/Erk signaling pathway via m6A demethylation of Rasal3 mRNA(A) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(B) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(C) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(D) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(E) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(F) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(G) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(H) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(I) A proposed model showing how ALKBH5 mediates mitochondrial dysfunction to induce CM death and mitigate DIC injury. Data are depicted as the mean +/- SEM. Statistical significance was determined by Student’s t test or one-way ANOVA or two-way ANOVA with a post-hoc Holm-Sidak test. Here, ns, not significant; ∗p < 0.05; ∗∗p < 0.05; ∗∗∗p < 0.001; ∗∗∗∗p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36876119), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RASAL3 Antibody - BSA Free

Western Blot: RASAL3 Antibody - BSA Free [NBP2-83439] -

ALKBH5 exerts cardioprotective effects by promoting the Ras/Raf/Erk signaling pathway via m6A demethylation of Rasal3 mRNA(A) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(B) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(C) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KO-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(D) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KO-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(E) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown.(F) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(G) Representative western blots of Rasal3, Ras-GTP (active Ras), phosphorylated cRaf (phos-cRaf), and phosphorylated Erk (phos-Erk1/2) in ALKBH5-KI-CM-DOX and WT-CM-DOX after OE-Rasal3 overexpression.(H) Western blot analysis of Rasal3 and Ras-GTP in ALKBH5-KI-CM-DOX and WT-CM-DOX after shRNA-Rasal3 knockdown (n = 3).(I) A proposed model showing how ALKBH5 mediates mitochondrial dysfunction to induce CM death and mitigate DIC injury. Data are depicted as the mean +/- SEM. Statistical significance was determined by Student’s t test or one-way ANOVA or two-way ANOVA with a post-hoc Holm-Sidak test. Here, ns, not significant; ∗p < 0.05; ∗∗p < 0.05; ∗∗∗p < 0.001; ∗∗∗∗p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36876119), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RASAL3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RASAL3

Alternate Names

RAS Protein Activator Like 3, RAS Protein Activator Like-3

Gene Symbol

RASAL3

Additional RASAL3 Products

Product Documents for RASAL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RASAL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...