PTPRH Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69289

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP1-69289 has been discontinued. View all PTPRH products.

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

View all PTPRH Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PTPRH(protein tyrosine phosphatase, receptor type, H) The peptide sequence was selected from the middle region of PTPRH. Peptide sequence QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

120 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PTPRH Antibody - BSA Free

Western Blot: PTPRH Antibody [NBP1-69289]

Western Blot: PTPRH Antibody [NBP1-69289]

Western Blot: PTPRH Antibody [NBP1-69289] - This Anti-PTPRH antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Applications for PTPRH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTPRH

PTPRH is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. The extracellular region contains eight fibronectin type III-like repeats and multiple N-glycosylation sites. It was also found to be expressed in several cancer cell lines, but not in the corresponding normal tissues.The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. The extracellular region contains eight fibronectin type III-like repeats and multiple N-glycosylation sites. The gene was shown to be expressed primarily in brain and liver, and at a lower level in heart and stomach. It was also found to be expressed in several cancer cell lines, but not in the corresponding normal tissues.

Alternate Names

EC 3.1.3.48, FLJ39938, MGC133058, MGC133059, protein tyrosine phosphatase, receptor type, H, receptor-type tyrosine-protein phosphatase H, R-PTP-H, SAP1, SAP-1, Stomach cancer-associated protein tyrosine phosphatase 1, Transmembrane-type protein-tyrosine phosphatase type H

Gene Symbol

PTPRH

UniProt

Q9HD43 (Human)

Additional PTPRH Products

Product Documents for PTPRH Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PTPRH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved. All trademarks and registered trademarks are the property of Bio-Techne and its brands unless otherwise specified.