Skip to main content

PPP2R1A Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38186

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PPP2R1A (NP_055040.2).

Sequence:
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PPP2R1A Antibody - BSA Free

PPP2R1A Antibody

Western Blot: PPP2R1A Antibody [NBP3-38186] -

Western Blot: PPP2R1A Antibody [NBP3-38186] - Western blot analysis of various lysates using PPP2R1A Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
PPP2R1A Antibody

Immunocytochemistry/ Immunofluorescence: PPP2R1A Antibody [NBP3-38186] -

Immunocytochemistry/ Immunofluorescence: PPP2R1A Antibody [NBP3-38186] - Immunofluorescence analysis of U2OS cells using PPP2R1A Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for PPP2R1A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PPP2R1A

PPP2R1A encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A.

Alternate Names

Medium tumor antigen-associated 61 kDa protein, MGC786, PP2A subunit A isoform PR65-alpha, PP2A subunit A isoform R1-alpha, PP2AAALPHA, PP2A-Aalpha, PR65A, protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alphaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform, protein phosphatase 2, regulatory subunit A, alpha, serine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, alphaisoform, serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alphaisoform

Gene Symbol

PPP2R1A

Additional PPP2R1A Products

Product Documents for PPP2R1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PPP2R1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...