Skip to main content

PHKA1 Antibody

Catalog # NBP2-83392 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83392-0.1ml

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for PHKA1 Antibody

Immunogen

The immunogen for Anti-PHKA1 antibody is: synthetic peptide directed towards the C-terminal of Human PHKA1. Peptide sequence: KQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PHKA1 Antibody

Western Blot: PHKA1 Antibody [NBP2-83392] - Host: Rabbit. Target Name: KPB1. Sample Type: 293T Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for PHKA1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHKA1

The PHKA1 gene encodes the alpha subunit of muscle phosphorylase kinase (EC 2.7.1.38), a key regulatory enzyme of glycogen metabolism. Phosphorylase kinase consists of 4 copies of an alpha-beta-gamma-delta tetramer. The alpha, beta (PHKB; MIM 172490), and gamma (PHKG1; MIM 172470 and PHKG2; MIM 172471) subunits have several isoforms; the delta subunit is calmodulin (CALM1; MIM 114180). PHKA2 (MIM 306000) encodes the alpha subunit of liver-specific phosphorylase kinase and is also located on the X chromosome.[supplied by OMIM]

Alternate Names

MGC132604, PHKA, phosphorylase b kinase regulatory subunit alpha skeletal muscle isoform, phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform, Phosphorylase kinase alpha M subunit, phosphorylase kinase, alpha 1 (muscle), phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis

Gene Symbol

PHKA1

Product Documents for PHKA1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PHKA1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...