Skip to main content

PCBP2 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57323

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-57323

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

1 mg/ml

Product Specifications

Immunogen

Synthetic peptides corresponding to PCBP2 (poly(rC) binding protein 2) The peptide sequence was selected from the middle region of PCBP2 (NP_005007). Peptide sequence VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PCBP2 Antibody - BSA Free

Western Blot: PCBP2 Antibody [NBP1-57323]

Western Blot: PCBP2 Antibody [NBP1-57323]

Western Blot: PCBP2 Antibody [NBP1-57323] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PCBP2 Antibody [NBP1-57323]

Immunohistochemistry: PCBP2 Antibody [NBP1-57323]

Immunohistochemistry: PCBP2 Antibody [NBP1-57323] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: PCBP2 Antibody [NBP1-57323]

Western Blot: PCBP2 Antibody [NBP1-57323]

Western Blot: PCBP2 Antibody [NBP1-57323] - Reccomended Titration: 1.25 ug/ml Positive Control: Jurkat cell lysate There is BioGPS gene expression data showing that PCBP2 is expressed in Jurkat

Applications for PCBP2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

4-8 ug/ml

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCBP2

PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes.The protein encoded by this gene appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1 intronless gene which has similar functions. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. It also has two processed pseudogenes PCBP2P1 and PCBP2P2. There are presently two alternatively spliced transcript variants described for this gene.

Alternate Names

alpha-CP2, Heterogeneous nuclear ribonucleoprotein E2, heterogenous nuclear ribonucleoprotein E2, hnRNP E2, hnRNP-E2, HNRPE2, MGC110998, poly(rC) binding protein 2, poly(rC)-binding protein 2

Entrez Gene IDs

5094 (Human)

Gene Symbol

PCBP2

UniProt

Additional PCBP2 Products

Product Documents for PCBP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PCBP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...
Loading...