Skip to main content

PCBP2 Antibody (4K6I6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-33275

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-33275-100ul
NBP3-33275-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 4K6I6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 220-350aa of human PCBP2 (NP_001122383.1)

Sequence:
PDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit PCBP2 Antibody (4K6I6) (NBP3-33275) is a monoclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PCBP2 Antibody (4K6I6)

PCBP2 Antibody (4K6I6)

Immunoprecipitation: PCBP2 Antibody (4K6I6) [NBP3-33275] -

Immunoprecipitation: PCBP2 Antibody (4K6I6) [NBP3-33275] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using PCBP2 antibody. Western blot was performed from the immunoprecipitate using hnRNP E2/PCBP2 antibody at a dilution of 1:1000.
PCBP2 Antibody (4K6I6)

Western Blot: PCBP2 Antibody (4K6I6) [NBP3-33275] -

Western Blot: PCBP2 Antibody (4K6I6) [NBP3-33275] - Western blot analysis of various lysates using PCBP2 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
PCBP2 Antibody (4K6I6)

Western Blot: PCBP2 Antibody (4K6I6) [NBP3-33275] -

Western Blot: PCBP2 Antibody (4K6I6) [NBP3-33275] - Western blot analysis of various lysates using PCBP2 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.

Applications for PCBP2 Antibody (4K6I6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PCBP2

PCBP2 is encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only three have been characterized to date.

Alternate Names

alpha-CP2, Heterogeneous nuclear ribonucleoprotein E2, heterogenous nuclear ribonucleoprotein E2, hnRNP E2, hnRNP-E2, HNRPE2, MGC110998, poly(rC) binding protein 2, poly(rC)-binding protein 2

Gene Symbol

PCBP2

Additional PCBP2 Products

Product Documents for PCBP2 Antibody (4K6I6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PCBP2 Antibody (4K6I6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...