Skip to main content

Parvalbumin Antibody

Catalog # NBP2-33529 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33529
NBP2-33529-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Parvalbumin Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28835932). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Parvalbumin Antibody

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Analysis in human parathyroid gland and liver tissues. Corresponding Parvalbumin RNA-seq data are presented for the same tissues.
Western Blot: Parvalbumin Antibody [NBP2-33529] - Analysis in human cell line RPMI-8226.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for Parvalbumin Antibody

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP2-33529 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Parvalbumin

Parvalbumin is encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation.

Alternate Names

D22S749, MGC116759, parvalbumin, parvalbumin alpha, PV

Gene Symbol

PVALB

UniProt

Product Documents for Parvalbumin Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Parvalbumin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...