Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86729

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86729
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Nicotinic Acetylcholine R alpha 10/CHRNA10. Peptide sequence: SHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free (NBP2-86729) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody [NBP2-86729]

Western Blot: Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody [NBP2-86729]

Western Blot: Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody [NBP2-86729] - WB Suggested Anti-ACH10 antibody Titration: 1 ug/mL. Sample Type: Human MCF7 Whole Cell

Applications for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 10/CHRNA10

Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding may induce an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma

Long Name

Nicotinic Acetylcholine Receptor alpha 10

Alternate Names

CHRNA10, NACHRA10, Nicotinic Acetylcholine Ra10

Gene Symbol

CHRNA10

Additional Nicotinic Acetylcholine R alpha 10/CHRNA10 Products

Product Documents for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.