Skip to main content

NBPF15 Antibody

Catalog # NBP3-09717 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-09717-100ul

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for NBPF15 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human NBPF15 (NP_001164226.1). Peptide sequence VQKLSPENDNDDDEDVQVEVAEKVQKSSAPREMQKAEEKEVPEDSLEECA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NBPF15 Antibody

Western Blot: NBPF15 Antibody [NBP3-09717] - Western blot analysis of NBPF15 in Human Placenta. Antibody dilution at 1ug/ml

Applications for NBPF15 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NBPF15

Alternate Names

AB14, Ag3, NBPF16, Neuroblastoma Breakpoint Family Member 15, Neuroblastoma Breakpoint Family Member 16, Neuroblastoma Breakpoint Family, Member 15, Neuroblastoma Breakpoint Family, Member 16

Gene Symbol

NBPF15

Product Documents for NBPF15 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NBPF15 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...